PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G111000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 325aa    MW: 37015.2 Da    PI: 4.8929
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G111000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.7e-092572912155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          + +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Manes.08G111000.1.p 257 RWPYPTEEEKVKLSEITGLDQKQINNWFINQRKRH 291
                          469*****************************885 PP

2ELK36.21.3e-12211232122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          +LK +LlrKYsgyL++L++EF+
  Manes.08G111000.1.p 211 DLKGMLLRKYSGYLSNLRKEFL 232
                          69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.8E-1967111IPR005540KNOX1
PfamPF037905.2E-1970109IPR005540KNOX1
SMARTSM012563.6E-25115166IPR005541KNOX2
PfamPF037916.0E-24119165IPR005541KNOX2
PfamPF037891.1E-9211232IPR005539ELK domain
SMARTSM011881.8E-6211232IPR005539ELK domain
PROSITE profilePS5121310.79211231IPR005539ELK domain
PROSITE profilePS5007112.681231294IPR001356Homeobox domain
SuperFamilySSF466893.25E-20233308IPR009057Homeodomain-like
SMARTSM003891.7E-13233298IPR001356Homeobox domain
CDDcd000868.20E-15234295No hitNo description
Gene3DG3DSA:1.10.10.604.7E-27236296IPR009057Homeodomain-like
PfamPF059205.6E-17251290IPR008422Homeobox KN domain
PROSITE patternPS000270269292IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEDLYRLDPT FACSNNIVTV ENFPSNFTAS TATTTNNAAH GFYTSVGNLL QFQAGSHARD  60
FESNILDLTK TQISNHPRYP DLVSAYIECR KVGAPPEIAS LLEEIGRENY STKVCSSEMG  120
ADPELDEFME SYCEVLHRYK EELSKPFDEA TTFLYDMESQ LNNLCKGTLS KTFDYYGSDE  180
AAGTSEEELS CGEFEASESQ ESSGGRPHDQ DLKGMLLRKY SGYLSNLRKE FLKKRKRGKL  240
PEVARMILLE WWKNHYRWPY PTEEEKVKLS EITGLDQKQI NNWFINQRKR HWKPSEDMRF  300
ALMDGVSSSS SMGGHSYFDT GGWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226235LRKEFLKKRK
2232239KKRKRGKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012089429.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-98KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLB9RFJ21e-175B9RFJ2_RICCO; Homeobox protein knotted-1, putative
STRINGPOPTR_0013s01000.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-87KNOTTED1-like homeobox gene 6